| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-5 |
|---|
| Ligand | BDBM50433122 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_956594 (CHEMBL2380080) |
|---|
| IC50 | 6500±n/a nM |
|---|
| Citation |  Venkateswararao, E; Sharma, VK; Lee, KC; Roh, E; Kim, Y; Jung, SH Design and synthesis of novel chromenone derivatives as interleukin-5 inhibitors. Bioorg Med Chem21:2543-50 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-5 |
|---|
| Name: | Interleukin-5 |
|---|
| Synonyms: | IL5_MOUSE | Il-5 | Il5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15414.97 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1464308 |
|---|
| Residue: | 133 |
|---|
| Sequence: | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ
LCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE
FLGVMSTEWAMEG
|
|
|
|---|
| BDBM50433122 |
|---|
| n/a |
|---|
| Name | BDBM50433122 |
|---|
| Synonyms: | CHEMBL2377406 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30O5 |
|---|
| Mol. Mass. | 422.5134 |
|---|
| SMILES | COc1ccc(cc1)C(O)CCc1coc2cccc(OCC3CCCCC3)c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
