Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
LigandBDBM50433272
Substrate/Competitorn/a
Meas. Tech.ChEMBL_957855
IC50 50±n/a nM
Citation Barlind JGBuckett LKCrosby SGDavidsson Emtenäs HErtan AJurva ULemurell MGutierrez PMNilsson KO'Mahony GPetersson AURedzic AWågberg FYuan ZQ Identification and design of a novel series of MGAT2 inhibitors. Bioorg Med Chem Lett 23:2721-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Name:Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Synonyms:GGNT1 | GLCT1 | GLYT1 | GNT-I | GlcNAc-T I | MGAT | MGAT1 | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
Type:PROTEIN
Mol. Mass.:50891.32
Organism:Homo sapiens (Human)
Description:ChEMBL_107587
Residue:445
Sequence:
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRR
CLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQ
GYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSA
WNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQG
RACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLA
RVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV
TFQFRGRRVHLAPPLTWEGYDPSWN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433272
n/a
NameBDBM50433272
Synonyms:CHEMBL2376325
TypeSmall organic molecule
Emp. Form.C18H18ClN3O4S
Mol. Mass.407.871
SMILESCCC1(C)NC(=O)c2cc(ccc2NC1=O)S(=O)(=O)Nc1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: