Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
LigandBDBM50433274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_957858
IC50 25±n/a nM
Citation Barlind JGBuckett LKCrosby SGDavidsson Emtenäs HErtan AJurva ULemurell MGutierrez PMNilsson KO'Mahony GPetersson AURedzic AWågberg FYuan ZQ Identification and design of a novel series of MGAT2 inhibitors. Bioorg Med Chem Lett 23:2721-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Name:Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Synonyms:Beta-1,2-N-acetylglucosaminyltransferase II | GNT-II | GlcNAc-T II | MGAT2 | Mannoside acetylglucosaminyltransferase 2 | Monoacylglycerol acyltransferase 2 (MGAT2) | Monoacylglycerol acyltransferase type 2 (h-MGAT2) | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II | h-MGAT2 (human monoacylglycerol acyltransferase type 2)
Type:n/a
Mol. Mass.:51567.80
Organism:Homo sapiens (Human)
Description:Q10469
Residue:447
Sequence:
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433274
n/a
NameBDBM50433274
Synonyms:CHEMBL2376321
TypeSmall organic molecule
Emp. Form.C19H19F2N3O5S
Mol. Mass.439.433
SMILESCC[C@]1(C)NC(=O)c2cc(ccc2NC1=O)S(=O)(=O)Nc1ccc(OC(F)F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: