Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 6/G1/S-specific cyclin D1
LigandBDBM50433369
Substrate/Competitorn/a
Meas. Tech.ChEMBL_956651
IC50 6.6±n/a nM
Citation Schonbrunn EBetzi SAlam RMartin MPBecker AHan HFrancis RChakrasali RJakkaraj SKazi ASebti SMCubitt CLGebhard AWHazlehurst LATash JSGeorg GI Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases. J Med Chem 56:3768-82 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 6/G1/S-specific cyclin D1
Name:Cyclin-dependent kinase 6/G1/S-specific cyclin D1
Synonyms:CDK6/cyclin D1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 640754
Components:This complex has 2 components.
Component 1
Name:Cyclin-dependent kinase 6
Synonyms:CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE
Type:Enzyme Subunit
Mol. Mass.:36937.42
Organism:Homo sapiens (Human)
Description:Q00534
Residue:326
Sequence:
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:G1/S-specific cyclin-D1
Synonyms:B-cell lymphoma 1 protein | BCL-1 | BCL-1 oncogene | CCND1 | PRAD1 oncogene
Type:Enzyme Subunit
Mol. Mass.:33717.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:295
Sequence:
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433369
n/a
NameBDBM50433369
Synonyms:CHEMBL2377825
TypeSmall organic molecule
Emp. Form.C16H13N5O5S2
Mol. Mass.419.435
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)sc1C(=O)c1ccccc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: