Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDK3/E
LigandBDBM50433369
Substrate/Competitorn/a
Meas. Tech.ChEMBL_956654
IC50 38±n/a nM
Citation Schonbrunn EBetzi SAlam RMartin MPBecker AHan HFrancis RChakrasali RJakkaraj SKazi ASebti SMCubitt CLGebhard AWHazlehurst LATash JSGeorg GI Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases. J Med Chem 56:3768-82 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CDK3/E
Name:CDK3/E
Synonyms:CDK3/Cyclin E
Type:Protein
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:CDK3/Cyclin E
Synonyms:CDK3 | Cyclin-dependent kinase 3
Type:Enzyme
Mol. Mass.:35053.88
Organism:Homo sapiens (Human)
Description:Q00526
Residue:305
Sequence:
MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:G1/S-specific cyclin-E1
Synonyms:CCNE | CCNE1
Type:Enzyme Subunit
Mol. Mass.:47073.17
Organism:Homo sapiens (Human)
Description:n/a
Residue:410
Sequence:
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433369
n/a
NameBDBM50433369
Synonyms:CHEMBL2377825
TypeSmall organic molecule
Emp. Form.C16H13N5O5S2
Mol. Mass.419.435
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)sc1C(=O)c1ccccc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: