Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase IV
LigandBDBM50433476
Substrate/Competitorn/a
Meas. Tech.ChEMBL_959646
IC50 26000±n/a nM
Citation Huang XCheng CCFischmann TODuca JSRichards MTadikonda PKReddy PAZhao LSiddiqui MAParry DDavis NSeghezzi WWiswell DShipps GW Structure-based design and optimization of 2-aminothiazole-4-carboxamide as a new class of CHK1 inhibitors. Bioorg Med Chem Lett 23:2590-4 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase IV
Name:CaM kinase IV
Synonyms:CAM kinase-GR | CAMK4 | CaMK IV | Calcium/calmodulin-dependent protein kinase type IV
Type:PROTEIN
Mol. Mass.:51919.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1459854
Residue:473
Sequence:
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433476
n/a
NameBDBM50433476
Synonyms:CHEMBL2381116
TypeSmall organic molecule
Emp. Form.C22H22N6O3S
Mol. Mass.450.513
SMILESCOc1ccc2CN(C(=O)c2c1)c1nc(cs1)C(=O)Nc1cnccc1N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: