Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50433784
Substrate/Competitorn/a
Meas. Tech.ChEMBL_958158
Ki>30000±n/a nM
Citation Wang TCQiao JXClark CGJua JPrice LAWu QChang MZheng JHuang CSEverlof GSchumacher WAWong PCSeiffert DAStewart ABBostwick JSCrain EJWatson CARehfuss RWexler RRLam PY Discovery of diarylurea P2Y(1) antagonists with improved aqueous solubility. Bioorg Med Chem Lett 23:3239-43 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:ADP-glucose receptor | ADPG-R | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | SP1999
Type:Enzyme
Mol. Mass.:39458.48
Organism:Homo sapiens (Human)
Description:Q9H244
Residue:342
Sequence:
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433784
n/a
NameBDBM50433784
Synonyms:CHEMBL2381898
TypeSmall organic molecule
Emp. Form.C31H33FN4O2
Mol. Mass.512.6177
SMILESCN(C)Cc1ccccc1-c1ccc(NC(=O)Nc2cccnc2Oc2ccccc2C(C)(C)C)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: