Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y2
LigandBDBM50433784
Substrate/Competitorn/a
Meas. Tech.ChEMBL_958159
Ki>30000±n/a nM
Citation Wang TCQiao JXClark CGJua JPrice LAWu QChang MZheng JHuang CSEverlof GSchumacher WAWong PCSeiffert DAStewart ABBostwick JSCrain EJWatson CARehfuss RWexler RRLam PY Discovery of diarylurea P2Y(1) antagonists with improved aqueous solubility. Bioorg Med Chem Lett 23:3239-43 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y2
Name:Purinergic receptor P2Y2
Synonyms:ATP receptor | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:42299.21
Organism:Homo sapiens (Human)
Description:ChEMBL_1455361
Residue:377
Sequence:
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433784
n/a
NameBDBM50433784
Synonyms:CHEMBL2381898
TypeSmall organic molecule
Emp. Form.C31H33FN4O2
Mol. Mass.512.6177
SMILESCN(C)Cc1ccccc1-c1ccc(NC(=O)Nc2cccnc2Oc2ccccc2C(C)(C)C)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: