Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y1
LigandBDBM50433792
Substrate/Competitorn/a
Meas. Tech.ChEMBL_958358
Ki 137±n/a nM
Citation Wang TCQiao JXClark CGJua JPrice LAWu QChang MZheng JHuang CSEverlof GSchumacher WAWong PCSeiffert DAStewart ABBostwick JSCrain EJWatson CARehfuss RWexler RRLam PY Discovery of diarylurea P2Y(1) antagonists with improved aqueous solubility. Bioorg Med Chem Lett 23:3239-43 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y1
Name:Purinergic receptor P2Y1
Synonyms:ATP receptor | P2Y purinoceptor 1 (P2Y1) | P2Y1 | Purinergic receptor
Type:Enzyme
Mol. Mass.:42090.25
Organism:Homo sapiens (Human)
Description:P47900
Residue:373
Sequence:
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433792
n/a
NameBDBM50433792
Synonyms:CHEMBL2381901
TypeSmall organic molecule
Emp. Form.C29H38N4O3
Mol. Mass.490.637
SMILESCN(C)CC(C)(C)COc1ccc(NC(=O)Nc2cccnc2Oc2ccccc2C(C)(C)C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: