Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalate dehydrogenase cytoplasmic
LigandBDBM23229
Substrate/Competitorn/a
Meas. Tech.ChEMBL_959386
IC50 6780±n/a nM
Citation Dragovich PSFauber BPCorson LBDing CZEigenbrot CGe HGiannetti AMHunsaker TLabadie SLiu YMalek SPan BPeterson DPitts KPurkey HESideris SUltsch MVanderPorten EWei BXu QYen IYue QZhang HZhang X Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase. Bioorg Med Chem Lett 23:3186-94 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Malate dehydrogenase cytoplasmic
Name:Malate dehydrogenase cytoplasmic
Synonyms:Cytosolic malate dehydrogenase | Malate dehydrogenase, cytoplasmic
Type:PROTEIN
Mol. Mass.:36427.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1456624
Residue:334
Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23229
n/a
NameBDBM23229
Synonyms:Oxamic acid derivative, 7 | [(4-{2-[(5-hydroxy-2-{[(4-methoxyphenyl)methyl]carbamoyl}-4-oxo-4H-chromen-7-yl)oxy]ethyl}-2-methoxyphenyl)carbamoyl]formic acid
TypeSmall organic molecule
Emp. Form.C29H26N2O10
Mol. Mass.562.5241
SMILESCOc1ccc(CNC(=O)c2cc(=O)c3c(O)cc(OCCc4ccc(NC(=O)C(O)=O)c(OC)c4)cc3o2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: