Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-regulated kinases 1B
LigandBDBM50434356
Substrate/Competitorn/a
Meas. Tech.ChEMBL_961004
IC50 0.240000±n/a nM
Citation Rosse G Tricyclic Pyrimidines As Inhibitors of DYRK1A/DYRK1B As Potential Treatment for Down's Syndrome or Alzheimer's Disease. ACS Med Chem Lett 4:502-3 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-regulated kinases 1B
Name:Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Synonyms:DYRK1B | Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Type:Enzyme
Mol. Mass.:69222.24
Organism:Homo sapiens (Human)
Description:Q9Y463
Residue:629
Sequence:
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50434356
n/a
NameBDBM50434356
Synonyms:CHEMBL2386744 | US9446044, 44
TypeSmall organic molecule
Emp. Form.C17H11BrFN5OS
Mol. Mass.432.27
SMILESCOC(=N)c1nc2ccc3ncnc(Nc4ccc(Br)cc4F)c3c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: