| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM50434654 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_960800 (CHEMBL2387969) |
|---|
| Ki | 0.037000±n/a nM |
|---|
| Citation |  Wang, X; Magnuson, S; Pastor, R; Fan, E; Hu, H; Tsui, V; Deng, W; Murray, J; Steffek, M; Wallweber, H; Moffat, J; Drummond, J; Chan, G; Harstad, E; Ebens, AJ Discovery of novel pyrazolo[1,5-a]pyrimidines as potent pan-Pim inhibitors by structure- and property-based drug design. Bioorg Med Chem Lett23:3149-53 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM50434654 |
|---|
| n/a |
|---|
| Name | BDBM50434654 |
|---|
| Synonyms: | CHEMBL2387465 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23F3N8O |
|---|
| Mol. Mass. | 520.509 |
|---|
| SMILES | F[C@H]1CNCC[C@@H]1CNc1ccn2ncc(C(=O)Nc3c[nH]c4ncc(cc34)-c3c(F)cccc3F)c2n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
