Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E synthase
LigandBDBM50360832
Substrate/Competitorn/a
Meas. Tech.ChEMBL_961192
IC50 9.1±n/a nM
Citation Shiro TKakiguchi KTakahashi HNagata HTobe M 7-Phenyl-imidazoquinolin-4(5H)-one derivatives as selective and orally available mPGES-1 inhibitors. Bioorg Med Chem 21:2868-78 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E synthase
Name:Prostaglandin E synthase
Synonyms:Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E2 synthase-1 ( mPGES-1)
Type:Protein
Mol. Mass.:17112.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:152
Sequence:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360832
n/a
NameBDBM50360832
Synonyms:CHEMBL1934810
TypeSmall organic molecule
Emp. Form.C16H9BrClN3O
Mol. Mass.374.619
SMILESClc1ccccc1-c1nc2c([nH]1)c(=O)[nH]c1cc(Br)ccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: