| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50434849 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_963356 (CHEMBL2388853) |
|---|
| IC50 | 0.500000±n/a nM |
|---|
| Citation |  Wu, Y; Aquino, CJ; Cowan, DJ; Anderson, DL; Ambroso, JL; Bishop, MJ; Boros, EE; Chen, L; Cunningham, A; Dobbins, RL; Feldman, PL; Harston, LT; Kaldor, IW; Klein, R; Liang, X; McIntyre, MS; Merrill, CL; Patterson, KM; Prescott, JS; Ray, JS; Roller, SG; Yao, X; Young, A; Yuen, J; Collins, JL Discovery of a highly potent, nonabsorbable apical sodium-dependent bile acid transporter inhibitor (GSK2330672) for treatment of type 2 diabetes. J Med Chem56:5094-114 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2_MOUSE | Na(+)-dependent ileal bile acid transporter | Ntcp2 | Slc10a2 | Sodium/taurocholate cotransporting polypeptide, ileal | Solute carrier family 10 member 2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38130.25 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_963356 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLG
HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID
GDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGM
FVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSL
GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF
AAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK
|
|
|
|---|
| BDBM50434849 |
|---|
| n/a |
|---|
| Name | BDBM50434849 |
|---|
| Synonyms: | CHEMBL2385105 | US9040518, 6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H32NO6PS |
|---|
| Mol. Mass. | 481.542 |
|---|
| SMILES | CCCC[C@]1(CC)CS(=O)(=O)c2cc(CP(O)(O)=O)c(OC)cc2[C@H](N1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
