Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM50434850 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_963356 (CHEMBL2388853) |
---|
IC50 | 0.300000±n/a nM |
---|
Citation | Wu, Y; Aquino, CJ; Cowan, DJ; Anderson, DL; Ambroso, JL; Bishop, MJ; Boros, EE; Chen, L; Cunningham, A; Dobbins, RL; Feldman, PL; Harston, LT; Kaldor, IW; Klein, R; Liang, X; McIntyre, MS; Merrill, CL; Patterson, KM; Prescott, JS; Ray, JS; Roller, SG; Yao, X; Young, A; Yuen, J; Collins, JL Discovery of a highly potent, nonabsorbable apical sodium-dependent bile acid transporter inhibitor (GSK2330672) for treatment of type 2 diabetes. J Med Chem56:5094-114 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2_MOUSE | Na(+)-dependent ileal bile acid transporter | Ntcp2 | Slc10a2 | Sodium/taurocholate cotransporting polypeptide, ileal | Solute carrier family 10 member 2 |
Type: | PROTEIN |
Mol. Mass.: | 38130.25 |
Organism: | Mus musculus |
Description: | ChEMBL_963356 |
Residue: | 348 |
Sequence: | MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLG
HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID
GDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGM
FVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSL
GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF
AAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK
|
|
|
BDBM50434850 |
---|
n/a |
---|
Name | BDBM50434850 |
Synonyms: | CHEMBL2387397 |
Type | Small organic molecule |
Emp. Form. | C25H34N2O5S |
Mol. Mass. | 474.613 |
SMILES | CCCC[C@]1(CC)CS(=O)(=O)c2cc(CNCC(O)=O)c(OC)cc2[C@H](N1)c1ccccc1 |r| |
Structure |
|