Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E synthase
LigandBDBM50435047
Substrate/Competitorn/a
Meas. Tech.ChEMBL_964546
IC50 3.0±n/a nM
Citation Arhancet GBWalker DPMetz SFobian YMHeasley SECarter JSSpringer JRJones DEHayes MJShaffer AFJerome GMBaratta MTZweifel BMoore WMMasferrer JLVazquez ML Discovery and SAR of PF-4693627, a potent, selective and orally bioavailable mPGES-1 inhibitor for the potential treatment of inflammation. Bioorg Med Chem Lett 23:1114-9 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E synthase
Name:Prostaglandin E synthase
Synonyms:Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E2 synthase-1 ( mPGES-1)
Type:Protein
Mol. Mass.:17112.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:152
Sequence:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50435047
n/a
NameBDBM50435047
Synonyms:CHEMBL2391299
TypeSmall organic molecule
Emp. Form.C26H29ClFN3O3
Mol. Mass.485.978
SMILESOC[C@H]1CCC[C@@H](C1)NC(=O)C1CCN(CC1)c1nc2cc(Cl)c(cc2o1)-c1ccc(F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: