Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM22568
Substrate/Competitorn/a
Meas. Tech.ChEMBL_965456
Ki 18±n/a nM
Citation Germain ARCarmody LCNag PPMorgan BVerplank LFernandez CDonckele EFeng YPerez JRDandapani SPalmer MLander ESGupta PBSchreiber SLMunoz B Cinnamides as selective small-molecule inhibitors of a cellular model of breast cancer stem cells. Bioorg Med Chem Lett 23:1834-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22568
n/a
NameBDBM22568
Synonyms:1-cyano-3-{2-[({2-[(diaminomethylidene)amino]-1,3-thiazol-4-yl}methyl)sulfanyl]ethyl}-2-methylguanidine | [3H]tiotidine | tiotidine
TypeSmall organic molecule
Emp. Form.C10H16N8S2
Mol. Mass.312.418
SMILES[#6]-[#7]-[#6](-[#7]C#N)=[#7]-[#6]-[#6]-[#16]-[#6]-c1csc(\[#7]=[#6](\[#7])-[#7])n1 |w:6.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: