| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50156454 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_965477 (CHEMBL2395281) |
|---|
| Ki | 0.220000±n/a nM |
|---|
| Citation |  Germain, AR; Carmody, LC; Nag, PP; Morgan, B; Verplank, L; Fernandez, C; Donckele, E; Feng, Y; Perez, JR; Dandapani, S; Palmer, M; Lander, ES; Gupta, PB; Schreiber, SL; Munoz, B Cinnamides as selective small-molecule inhibitors of a cellular model of breast cancer stem cells. Bioorg Med Chem Lett23:1834-8 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50156454 |
|---|
| n/a |
|---|
| Name | BDBM50156454 |
|---|
| Synonyms: | CHEMBL264100 | des-Arg10-Kallidin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C50H73N13O11 |
|---|
| Mol. Mass. | 1032.1951 |
|---|
| SMILES | NCCCC[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
