| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50014210 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_964937 (CHEMBL2395634) |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  Arunotayanun, W; Dalley, JW; Huang, XP; Setola, V; Treble, R; Iversen, L; Roth, BL; Gibbons, S An analysis of the synthetic tryptamines AMT and 5-MeO-DALT: emerging 'Novel Psychoactive Drugs'. Bioorg Med Chem Lett23:3411-5 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50014210 |
|---|
| n/a |
|---|
| Name | BDBM50014210 |
|---|
| Synonyms: | 1-(1H-Indol-3-yl)-2-propanamine | 1-(1H-indol-3-yl)propan-2-amine | 3-(2-Aminopropyl)indole | CHEMBL30713 | DL-3-(2-Aminopropyl)indole | Indopan | alpha-Methyl-1H-indole-3-ethanamine | alpha-Methyl-3-indoleethanamine | alpha-Methyl-beta-indoleethylamine | alpha-methyltryptamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14N2 |
|---|
| Mol. Mass. | 174.2423 |
|---|
| SMILES | CC(N)Cc1c[nH]c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
