Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutaminyl Cyclase
LigandBDBM50435549
Substrate/Competitorn/a
Meas. Tech.ChEMBL_966260
IC50 123±n/a nM
Citation Tran PTHoang VHThorat SAKim SEAnn JChang YJNam DWSong HMook-Jung ILee JLee J Structure-activity relationship of human glutaminyl cyclase inhibitors having an N-(5-methyl-1H-imidazol-1-yl)propyl thiourea template. Bioorg Med Chem 21:3821-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutaminyl Cyclase
Name:Glutaminyl-peptide cyclotransferase
Synonyms:Glutaminyl cyclase (QC) | Glutaminyl-peptide cyclotransferase | Glutaminyl-peptide cyclotransferase precursor (QC) | Glutaminyl-tRNA cyclotransferase | Glutamyl cyclase (QC)
Type:Enzyme
Mol. Mass.:40877.05
Organism:Homo sapiens (Human)
Description:Q16769
Residue:361
Sequence:
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGT
SISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSF
SNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLS
LKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHG
MDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYG
GVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLH
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50435549
n/a
NameBDBM50435549
Synonyms:CHEMBL2392800
TypeSmall organic molecule
Emp. Form.C15H16N4O2
Mol. Mass.284.3131
SMILESCc1cncn1CCCn1c(=O)[nH]c2ccccc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: