Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
LigandBDBM50174298
Substrate/Competitorn/a
Meas. Tech.ChEMBL_965016
IC50 3.0±n/a nM
Citation Bauman DRWhitehead AContino LCCui JGarcia-Calvo MGu XKevin NMa XPai LYShah KShen XStribling SZokian HJMetzger JShevell DEWaddell ST Evaluation of selective inhibitors of 11-HSD1 for the treatment of hypertension. Bioorg Med Chem Lett 23:3650-3 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
Name:11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
Synonyms:11-DH | 11-beta-HSD1 | 11-beta-hydroxysteroid dehydrogenase 1 | Corticosteroid 11-beta-dehydrogenase isozyme 1 | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11-beta-HSD-1)
Type:Enzyme
Mol. Mass.:31889.48
Organism:Rattus norvegicus (rat)
Description:P16232
Residue:288
Sequence:
MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLT
ARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQT
TMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYS
ASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALE
IIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174298
n/a
NameBDBM50174298
Synonyms:3-(4-(3-(4-fluorophenyl)-1,2,4-oxadiazol-5-yl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole | CHEMBL373257
TypeSmall organic molecule
Emp. Form.C26H23F4N5O
Mol. Mass.497.4873
SMILESCn1c(nnc1C12CCC(CC1)(CC2)c1nc(no1)-c1ccc(F)cc1)-c1ccccc1C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: