Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide hydratase
LigandBDBM50435756
Substrate/Competitorn/a
Meas. Tech.ChEMBL_965765
IC50 1.000000±n/a nM
Citation Thalji RKMcAtee JJBelyanskaya SBrandt MBrown GDCostell MHDing YDodson JWEisennagel SHFries REGross JWHarpel MRHolt DAIsrael DIJolivette LJKrosky DLi HLu QMandichak TRoethke TSchnackenberg CGSchwartz BShewchuk LMXie WBehm DJDouglas SAShaw ALMarino JP Discovery of 1-(1,3,5-triazin-2-yl)piperidine-4-carboxamides as inhibitors of soluble epoxide hydrolase. Bioorg Med Chem Lett 23:3584-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epoxide hydratase
Name:Epoxide hydratase
Synonyms:Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50435756
n/a
NameBDBM50435756
Synonyms:CHEMBL2392695
TypeSmall organic molecule
Emp. Form.C20H25F3N6O
Mol. Mass.422.4473
SMILESCN(C)c1nc(C)nc(n1)N1CCC(CC1)C(=O)NCc1ccccc1C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: