Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor GPR35
LigandBDBM50436005
Substrate/Competitorn/a
Meas. Tech.ChEMBL_964307
EC50 1100±n/a nM
Citation Funke MThimm DSchiedel ACMüller CE 8-Benzamidochromen-4-one-2-carboxylic acids: potent and selective agonists for the orphan G protein-coupled receptor GPR35. J Med Chem 56:5182-97 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor GPR35
Name:G protein-coupled receptor GPR35
Synonyms:GPR35
Type:PROTEIN
Mol. Mass.:34295.07
Organism:Rattus norvegicus
Description:ChEMBL_107605
Residue:306
Sequence:
MNNTNCSILPWPAAVNHIFTIYLVLLLVLGLLLNGLALWVFCYRMHQWTETRVYMTNLAV
ADVCLLCSLPFVLYSLKYSTSDTPICQLSQGIYLVNRYMSISLVTAIAVDRYVAVRHPLR
ARELRSPRQAGAVCVALWVIVVTSLVLRWRLGIQEGGFCFSSQNRYNFSTTAFSLLGFYL
PLAIVVFCSLQVVTALARRPATDVEQVEATQKATRMVWANLAVFIICFLPLHLILTVQVS
LNLHTCAARNIFSRALTITAKLSDINCCLDAICYYYMAKEFQDASLRATASSTPHKSQDT
QSLSLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50436005
n/a
NameBDBM50436005
Synonyms:CHEMBL2392176
TypeSmall organic molecule
Emp. Form.C18H12BrNO6
Mol. Mass.418.195
SMILESCOc1ccccc1C(=O)Nc1cc(Br)cc2c1oc(cc2=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: