Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 35
LigandBDBM50436005
Substrate/Competitorn/a
Meas. Tech.ChEMBL_964310
EC50 4950±n/a nM
Citation Funke MThimm DSchiedel ACMüller CE 8-Benzamidochromen-4-one-2-carboxylic acids: potent and selective agonists for the orphan G protein-coupled receptor GPR35. J Med Chem 56:5182-97 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 35
Name:G-protein coupled receptor 35
Synonyms:Gpr35 | KYNA receptor | Kynurenic acid receptor
Type:PROTEIN
Mol. Mass.:34163.11
Organism:Mus musculus
Description:ChEMBL_107606
Residue:307
Sequence:
MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYRMHQWTETRIYMTNLA
VADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISLVTAIAVDRYVAVRHPL
RARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSSQTRRNFSTTAFSLLGFY
LPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANLAVFVICFLPLHVVLTVQV
SLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMAREFQEASKPATSSNTPHKSQD
SQILSLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50436005
n/a
NameBDBM50436005
Synonyms:CHEMBL2392176
TypeSmall organic molecule
Emp. Form.C18H12BrNO6
Mol. Mass.418.195
SMILESCOc1ccccc1C(=O)Nc1cc(Br)cc2c1oc(cc2=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: