Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 4
LigandBDBM50436476
Substrate/Competitorn/a
Meas. Tech.ChEMBL_966443
IC50 4600±n/a nM
Citation Décor AGrand-Maître CHucke OO'Meara JKuhn CConstantineau-Forget LBrochu CMalenfant EBertrand-Laperle MBordeleau JGhiro EPesant MFazal GGorys VLittle MBoucher CBordeleau STurcotte PGuo TGarneau MSpickler CGauthier A Design, synthesis and biological evaluation of novel aminothiazoles as antiviral compounds acting against human rhinovirus. Bioorg Med Chem Lett 23:3841-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha 4
Name:Ribosomal protein S6 kinase alpha 4
Synonyms:90 kDa ribosomal protein S6 kinase 4 | Mitogen- and Stress-Activated Protein Kinase 2 (MSK2) | Nuclear mitogen- and stress-activated protein kinase 2 | RSKB | Ribosomal protein S6 kinase alpha-4 | Ribosomal protein kinase B
Type:Serine/threonine-protein kinase
Mol. Mass.:85620.38
Organism:Homo sapiens (Human)
Description:Recombinant MSK2 was phosphorylated by incubation with active p38alpha before assays.
Residue:772
Sequence:
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50436476
n/a
NameBDBM50436476
Synonyms:CHEMBL2397316
TypeSmall organic molecule
Emp. Form.C15H17F3N4OS
Mol. Mass.358.382
SMILESCc1nc(NC(=O)C(C)(C)CC(F)(F)F)sc1-c1ccc(N)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: