| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM34005 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_974636 (CHEMBL2410562) |
|---|
| IC50 | 800±n/a nM |
|---|
| Citation |  Moore, JD; Potter, A Pin1 inhibitors: Pitfalls, progress and cellular pharmacology. Bioorg Med Chem Lett23:4283-91 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM34005 |
|---|
| n/a |
|---|
| Name | BDBM34005 |
|---|
| Synonyms: | pipecolate deriv., 12b |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H45N2O7P |
|---|
| Mol. Mass. | 636.7148 |
|---|
| SMILES | OP(O)(=O)OC[C@@H](Cc1ccccc1)NC(=O)N1CCCC[C@H]1C(=O)OC(CCCc1ccccc1)CCCc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
