| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 |
|---|
| Ligand | BDBM50437711 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_974637 (CHEMBL2410563) |
|---|
| IC50 | 1500±n/a nM |
|---|
| Citation |  Moore, JD; Potter, A Pin1 inhibitors: Pitfalls, progress and cellular pharmacology. Bioorg Med Chem Lett23:4283-91 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 |
|---|
| Synonyms: | PIN4 | PIN4_HUMAN | PPIase Pin4 | Par14 | Parvulin 14 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 2 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 | Peptidyl-prolyl cis/trans isomerase EPVH | Rotamase Pin4 | hPar14 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13820.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502606 |
|---|
| Residue: | 131 |
|---|
| Sequence: | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
|
|
|
|---|
| BDBM50437711 |
|---|
| n/a |
|---|
| Name | BDBM50437711 |
|---|
| Synonyms: | CHEMBL2409076 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N2O8 |
|---|
| Mol. Mass. | 438.3869 |
|---|
| SMILES | CCOC(=O)Cn1c(=O)c2ccc3c4c(ccc(c24)c1=O)c(=O)n(CC(=O)OCC)c3=O |
|---|
| Structure | 
|
|---|
Search and Browse
