Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase NIMA-interacting 2
LigandBDBM50437711
Substrate/Competitorn/a
Meas. Tech.ChEMBL_974637
IC50 1500±n/a nM
Citation Moore JDPotter A Pin1 inhibitors: Pitfalls, progress and cellular pharmacology. Bioorg Med Chem Lett 23:4283-91 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 2
Name:Peptidyl-prolyl cis-trans isomerase NIMA-interacting 2
Synonyms:PPIase Pin4 | Par14 | Parvulin 14 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 | Peptidyl-prolyl cis/trans isomerase EPVH | Rotamase Pin4 | hPar14
Type:PROTEIN
Mol. Mass.:13820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1502606
Residue:131
Sequence:
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437711
n/a
NameBDBM50437711
Synonyms:CHEMBL2409076
TypeSmall organic molecule
Emp. Form.C22H18N2O8
Mol. Mass.438.3869
SMILESCCOC(=O)Cn1c(=O)c2ccc3c4c(ccc(c24)c1=O)c(=O)n(CC(=O)OCC)c3=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: