Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 1
LigandBDBM50437983
Substrate/Competitorn/a
Meas. Tech.ChEMBL_972875
EC50 160±n/a nM
Citation Wen WWu WRomaine IMKaufmann KDu YSulikowski GAWeaver CDLindsley CW Discovery of 'molecular switches' within a GIRK activator scaffold that afford selective GIRK inhibitors. Bioorg Med Chem Lett 23:4562-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-activated inward rectifier potassium channel 1
Name:G protein-activated inward rectifier potassium channel 1
Synonyms:GIRK-1 | GIRK1 | Inward rectifier K(+) channel Kir3.1 | KCNJ3 | Potassium channel, inwardly rectifying subfamily J member 3
Type:PROTEIN
Mol. Mass.:56610.74
Organism:Homo sapiens (Human)
Description:ChEMBL_107915
Residue:501
Sequence:
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437983
n/a
NameBDBM50437983
Synonyms:CHEMBL2409106
TypeSmall organic molecule
Emp. Form.C17H14F2N4O
Mol. Mass.328.3161
SMILESCc1cc(NC(=O)Nc2ccc(F)c(F)c2)n(n1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: