Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 4
LigandBDBM50437986
Substrate/Competitorn/a
Meas. Tech.ChEMBL_972867
IC50 690±n/a nM
Citation Wen WWu WRomaine IMKaufmann KDu YSulikowski GAWeaver CDLindsley CW Discovery of 'molecular switches' within a GIRK activator scaffold that afford selective GIRK inhibitors. Bioorg Med Chem Lett 23:4562-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-activated inward rectifier potassium channel 4
Name:G protein-activated inward rectifier potassium channel 4
Synonyms:CIR | Cardiac inward rectifier | GIRK-4 | GIRK4 | Heart KATP channel | IRK-4 | Inward rectifier K(+) channel Kir3.4 | KATP-1 | KCNJ5 | Potassium channel, inwardly rectifying subfamily J member 5
Type:PROTEIN
Mol. Mass.:47658.06
Organism:Homo sapiens (Human)
Description:ChEMBL_107914
Residue:419
Sequence:
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437986
n/a
NameBDBM50437986
Synonyms:CHEMBL2409103
TypeSmall organic molecule
Emp. Form.C21H19F3N4O
Mol. Mass.400.397
SMILESFC(F)(F)c1cccc(NC(=O)Nc2cc(nn2-c2ccccc2)C2CCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: