| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-14 |
|---|
| Ligand | BDBM33437 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_973067 (CHEMBL2412648) |
|---|
| pH | 8±n/a |
|---|
| IC50 | >30000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Tan, X; Furio, L; Reboud-Ravaux, M; Villoutreix, BO; Hovnanian, A; El Amri, C 1,2,4-Triazole derivatives as transient inactivators of kallikreins involved in skin diseases. Bioorg Med Chem Lett23:4547-51 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-14 |
|---|
| Name: | Kallikrein-14 |
|---|
| Synonyms: | KLK-L6 | KLK14 | KLK14_HUMAN | KLKL6 | Kallikrein 14 | Kallikrein-14 | Kallikrein-like protein 6 | hK14 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29136.99 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1282452 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA
GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN
SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC
VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER
CALPGYPGVYTNLCKYRSWIEETMRDK
|
|
|
|---|
| BDBM33437 |
|---|
| n/a |
|---|
| Name | BDBM33437 |
|---|
| Synonyms: | (5-amino-3-phenyl-1,2,4-triazol-1-yl)-(3,4-dimethoxyphenyl)methanone | (5-azanyl-3-phenyl-1,2,4-triazol-1-yl)-(3,4-dimethoxyphenyl)methanone | 1-(3,4-dimethoxybenzoyl)-3-phenyl-1H-1,2,4-triazol-5-amine | MLS000099650 | SMR000074479 | cid_975107 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H16N4O3 |
|---|
| Mol. Mass. | 324.3339 |
|---|
| SMILES | COc1ccc(cc1OC)C(=O)n1nc(nc1N)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
