| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-7 |
|---|
| Ligand | BDBM33882 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_973068 (CHEMBL2412649) |
|---|
| IC50 | 220±n/a nM |
|---|
| Citation |  Tan, X; Furio, L; Reboud-Ravaux, M; Villoutreix, BO; Hovnanian, A; El Amri, C 1,2,4-Triazole derivatives as transient inactivators of kallikreins involved in skin diseases. Bioorg Med Chem Lett23:4547-51 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-7 |
|---|
| Name: | Kallikrein-7 |
|---|
| Synonyms: | KLK7 | KLK7_HUMAN | Kallikrein 7 | Kallikrein-7 | PRSS6 | SCCE | Serine protease 6 | Stratum corneum chymotryptic enzyme | hK7 | hSCCE | kallikrein-7 isoform 1 preproprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27535.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469257 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR
|
|
|
|---|
| BDBM33882 |
|---|
| n/a |
|---|
| Name | BDBM33882 |
|---|
| Synonyms: | (5-amino-3-pyridin-3-yl-1,2,4-triazol-1-yl)-(4-chlorophenyl)methanone | (5-azanyl-3-pyridin-3-yl-1,2,4-triazol-1-yl)-(4-chlorophenyl)methanone | 1-(4-chlorobenzoyl)-3-pyridin-3-yl-1H-1,2,4-triazol-5-amine | MLS000727811 | SMR000306508 | [5-amino-3-(3-pyridinyl)-1,2,4-triazol-1-yl]-(4-chlorophenyl)methanone | [5-amino-3-(3-pyridyl)-1,2,4-triazol-1-yl]-(4-chlorophenyl)methanone | cid_5000438 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H10ClN5O |
|---|
| Mol. Mass. | 299.715 |
|---|
| SMILES | Nc1nc(nn1C(=O)c1ccc(Cl)cc1)-c1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
