Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50438361 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_973546 (CHEMBL2410948) |
---|
IC50 | 5.0±n/a nM |
---|
Citation | Ng, RA; Sun, M; Bowers, S; Hom, RK; Probst, GD; John, V; Fang, LY; Maillard, M; Gailunas, A; Brogley, L; Neitz, RJ; Tung, JS; Pleiss, MA; Konradi, AW; Sham, HL; Dappen, MS; Adler, M; Yao, N; Zmolek, W; Nakamura, D; Quinn, KP; Sauer, JM; Bova, MP; Ruslim, L; Artis, DR; Yednock, TA Design and synthesis of hydroxyethylamine (HEA) BACE-1 inhibitors: prime side chromane-containing inhibitors. Bioorg Med Chem Lett23:4674-9 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50438361 |
---|
n/a |
---|
Name | BDBM50438361 |
Synonyms: | CHEMBL2408753 |
Type | Small organic molecule |
Emp. Form. | C29H40F2N2O4 |
Mol. Mass. | 518.6357 |
SMILES | COC[C@@]1(C)C[C@H](NC[C@@H](O)[C@H](Cc2cc(F)cc(F)c2)NC(C)=O)c2cc(CC(C)(C)C)ccc2O1 |r| |
Structure |
|