| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50438477 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_976205 (CHEMBL2415854) |
|---|
| Ki | 420±n/a nM |
|---|
| Citation |  Clinch, K; Crump, DR; Evans, GB; Hazleton, KZ; Mason, JM; Schramm, VL; Tyler, PC Acyclic phosph(on)ate inhibitors of Plasmodium falciparum hypoxanthine-guanine-xanthine phosphoribosyltransferase. Bioorg Med Chem21:5629-46 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50438477 |
|---|
| n/a |
|---|
| Name | BDBM50438477 |
|---|
| Synonyms: | CHEMBL2414638 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H16FN4O5P |
|---|
| Mol. Mass. | 334.2407 |
|---|
| SMILES | OC[C@H](CC(F)P(O)(O)=O)NCc1c[nH]c2c1nc[nH]c2=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
