Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHeme Oxygenase 2 (HO-2)
LigandBDBM50240895
Substrate/Competitorn/a
Meas. Tech.ChEMBL_976174
IC50>100000±n/a nM
Citation Salerno LPittalà VRomeo GModica MNSiracusa MADi Giacomo CAcquaviva RBarbagallo ITibullo DSorrenti V Evaluation of novel aryloxyalkyl derivatives of imidazole and 1,2,4-triazole as heme oxygenase-1 (HO-1) inhibitors and their antitumor properties. Bioorg Med Chem 21:5145-53 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Heme Oxygenase 2 (HO-2)
Name:Heme Oxygenase 2 (HO-2)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:35754.99
Organism:Rattus norvegicus (rat)
Description:HO-2 obtained from rat brain was used in enzyme assays.
Residue:315
Sequence:
MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENW
EEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTG
EGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAG
SMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILA
ASVALVAGLLAWYYM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240895
n/a
NameBDBM50240895
Synonyms:2-(1H-Imidazol-1-yl)-1-(4-nitrophenyl)ethanone | 2-Imidazol-1-yl-1-(4-nitro-phenyl)-ethanone | CHEMBL162549
TypeSmall organic molecule
Emp. Form.C11H9N3O3
Mol. Mass.231.2075
SMILES[O-][N+](=O)c1ccc(cc1)C(=O)Cn1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: