| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM50438651 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_976175 (CHEMBL2415824) |
|---|
| IC50 | 1000±n/a nM |
|---|
| Citation |  Salerno, L; Pittalà, V; Romeo, G; Modica, MN; Siracusa, MA; Di Giacomo, C; Acquaviva, R; Barbagallo, I; Tibullo, D; Sorrenti, V Evaluation of novel aryloxyalkyl derivatives of imidazole and 1,2,4-triazole as heme oxygenase-1 (HO-1) inhibitors and their antitumor properties. Bioorg Med Chem21:5145-53 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM50438651 |
|---|
| n/a |
|---|
| Name | BDBM50438651 |
|---|
| Synonyms: | CHEMBL2414454 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15IN2O |
|---|
| Mol. Mass. | 342.1755 |
|---|
| SMILES | Ic1ccc(OCCCCn2ccnc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
