Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 1
LigandBDBM50439422
Substrate/Competitorn/a
Meas. Tech.ChEMBL_980173
EC50 2900±n/a nM
Citation Ramos-Hunter SJEngers DWKaufmann KDu YLindsley CWWeaver CDSulikowski GA Discovery and SAR of a novel series of GIRK1/2 and GIRK1/4 activators. Bioorg Med Chem Lett 23:5195-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-activated inward rectifier potassium channel 1
Name:G protein-activated inward rectifier potassium channel 1
Synonyms:GIRK-1 | GIRK1 | Inward rectifier K(+) channel Kir3.1 | KCNJ3 | Potassium channel, inwardly rectifying subfamily J member 3
Type:PROTEIN
Mol. Mass.:56610.74
Organism:Homo sapiens (Human)
Description:ChEMBL_107915
Residue:501
Sequence:
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50439422
n/a
NameBDBM50439422
Synonyms:CHEMBL2420542
TypeSmall organic molecule
Emp. Form.C17H20ClN3O3S
Mol. Mass.381.877
SMILESCN(C)S(=O)(=O)c1cc(NC(=O)Nc2ccc(C)c(Cl)c2)ccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: