new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50035444
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982135
IC50 0.072000±n/a nM
Citation  TBA Med Chem Res 0:1-17 (2013)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035444
n/a
NameBDBM50035444
Synonyms:4-[[2'-[N-(tert-Butoxycarbonyl)sulfamoyl]biphenyl-4-yl]methyl]-5-n-butyl-2-[2-chloro-5-(valerylamino)phenyl]-2,4-dihydro-3H-1,2,4-trizol-3-one | CHEMBL341828
TypeSmall organic molecule
Emp. Form.C35H42ClN5O6S
Mol. Mass.696.256
SMILESCCCCC(=O)Nc1ccc(Cl)c(c1)-n1nc(CCCC)n(Cc2ccc(cc2)-c2ccccc2S(=O)(=O)NC(=O)OC(C)(C)C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: