Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 35
LigandBDBM50185
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982934
Ki 8.8±n/a nM
Citation Thimm DFunke MMeyer AMüller CE 6-Bromo-8-(4-[(3)H]methoxybenzamido)-4-oxo-4H-chromene-2-carboxylic Acid: a powerful tool for studying orphan G protein-coupled receptor GPR35. J Med Chem 56:7084-99 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 35
Name:G-protein coupled receptor 35
Synonyms:G protein-coupled receptor 35
Type:Enzyme Catalytic Domain
Mol. Mass.:34085.57
Organism:Homo sapiens (Human)
Description:gi_33695097
Residue:309
Sequence:
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185
n/a
NameBDBM50185
Synonyms:2-hydroxy-4-({4-[5-(2-methyl-3-phenyl-2-propen-1-ylidene)-4-oxo-2-thioxo-1,3-thiazolidin-3-yl]butanoyl}amino)benzoic acid | 2-hydroxy-4-[4-[(5Z)-4-keto-5-[(E)-2-methyl-3-phenyl-prop-2-enylidene]-2-thioxo-thiazolidin-3-yl]butanoylamino]benzoic acid | 2-hydroxy-4-[4-[(5Z)-5-[(E)-2-methyl-3-phenylprop-2-enylidene]-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]butanoylamino]benzoic acid | 2-hydroxy-4-[[4-[(5Z)-5-[(E)-2-methyl-3-phenylprop-2-enylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]-1-oxobutyl]amino]benzoic acid | 4-[4-[(5Z)-5-[(E)-2-methyl-3-phenyl-prop-2-enylidene]-4-oxidanylidene-2-sulfanylidene-1,3-thiazolidin-3-yl]butanoylamino]-2-oxidanyl-benzoic acid | CHEMBL1384502 | MLS000575039 | SMR000208964 | cid_2286812
TypeSmall organic molecule
Emp. Form.C24H22N2O5S2
Mol. Mass.482.572
SMILESC\C(\C=C1/SC(=S)N(CCCC(=O)Nc2ccc(C(O)=O)c(O)c2)C1=O)=C/c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: