Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeoxycytidine kinase
LigandBDBM50440153
Substrate/Competitorn/a
Meas. Tech.ChEMBL_981695
IC50 265±n/a nM
Citation Murphy JMArmijo ALNomme JLee CHSmith QALi ZCampbell DOLiao HINathanson DAAustin WRLee JTDarvish RWei LWang JSu YDamoiseaux RSadeghi SPhelps MEHerschman HRCzernin JAlexandrova ANJung MELavie ARadu CG Development of new deoxycytidine kinase inhibitors and noninvasive in vivo evaluation using positron emission tomography. J Med Chem 56:6696-708 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Deoxycytidine kinase
Name:Deoxycytidine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30361.42
Organism:Mus musculus
Description:ChEMBL_981695
Residue:260
Sequence:
MATPPKRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQASEDWEVVPEPVARWCN
VQSTQEEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTSFDYLQEVPVLTLDVNE
DFKDKHESLVEKVKEFLSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440153
n/a
NameBDBM50440153
Synonyms:CHEMBL2426460
TypeSmall organic molecule
Emp. Form.C16H16FN5S2
Mol. Mass.361.46
SMILESCCc1sc(nc1CSc1nc(N)cc(N)n1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: