Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50440262 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_982014 (CHEMBL2428369) |
---|
IC50 | 16±n/a nM |
---|
Citation | McClure, KF; Jackson, M; Cameron, KO; Kung, DW; Perry, DA; Orr, ST; Zhang, Y; Kohrt, J; Tu, M; Gao, H; Fernando, D; Jones, R; Erasga, N; Wang, G; Polivkova, J; Jiao, W; Swartz, R; Ueno, H; Bhattacharya, SK; Stock, IA; Varma, S; Bagdasarian, V; Perez, S; Kelly-Sullivan, D; Wang, R; Kong, J; Cornelius, P; Michael, L; Lee, E; Janssen, A; Steyn, SJ; Lapham, K; Goosen, T Identification of potent, selective, CNS-targeted inverse agonists of the ghrelin receptor. Bioorg Med Chem Lett23:5410-4 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50440262 |
---|
n/a |
---|
Name | BDBM50440262 |
Synonyms: | CHEMBL2426674 |
Type | Small organic molecule |
Emp. Form. | C27H29ClN4O2 |
Mol. Mass. | 476.998 |
SMILES | COc1ccc(CC(=O)N2CCC3(CN(Cc4ccc(cc4Cl)-c4ncccn4)C3)CC2)cc1 |
Structure |
|