Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50005094
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982012
Ki 48±n/a nM
Citation McClure KFJackson MCameron KOKung DWPerry DAOrr STZhang YKohrt JTu MGao HFernando DJones RErasga NWang GPolivkova JJiao WSwartz RUeno HBhattacharya SKStock IAVarma SBagdasarian VPerez SKelly-Sullivan DWang RKong JCornelius PMichael LLee EJanssen ASteyn SJLapham KGoosen T Identification of potent, selective, CNS-targeted inverse agonists of the ghrelin receptor. Bioorg Med Chem Lett 23:5410-4 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005094
n/a
NameBDBM50005094
Synonyms:CHEMBL2424680
TypeSmall organic molecule
Emp. Form.C29H35N5O2
Mol. Mass.485.6205
SMILESCOc1ccc(CC(=O)N2CCC3(CN(C3)[C@H](C(C)C)c3ccc(cc3)-c3ncccn3)CC2)nc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: