| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Muscarinic acetylcholine receptor M2 |
|---|
| Ligand | BDBM50005094 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_982012 (CHEMBL2428367) |
|---|
| Ki | 48±n/a nM |
|---|
| Citation |  McClure, KF; Jackson, M; Cameron, KO; Kung, DW; Perry, DA; Orr, ST; Zhang, Y; Kohrt, J; Tu, M; Gao, H; Fernando, D; Jones, R; Erasga, N; Wang, G; Polivkova, J; Jiao, W; Swartz, R; Ueno, H; Bhattacharya, SK; Stock, IA; Varma, S; Bagdasarian, V; Perez, S; Kelly-Sullivan, D; Wang, R; Kong, J; Cornelius, P; Michael, L; Lee, E; Janssen, A; Steyn, SJ; Lapham, K; Goosen, T Identification of potent, selective, CNS-targeted inverse agonists of the ghrelin receptor. Bioorg Med Chem Lett23:5410-4 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Muscarinic acetylcholine receptor M2 |
|---|
| Name: | Muscarinic acetylcholine receptor M2 |
|---|
| Synonyms: | ACM2_HUMAN | CHRM2 | Cholinergic, muscarinic M2 | Muscarinic acetylcholine receptor M2 and M4 | Muscarinic acetylcholine receptor M2 and M5 | RecName: Full=Muscarinic acetylcholine receptor M2 |
|---|
| Type: | GPCR |
|---|
| Mol. Mass.: | 51730.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08172 |
|---|
| Residue: | 466 |
|---|
| Sequence: | MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
|
|
|
|---|
| BDBM50005094 |
|---|
| n/a |
|---|
| Name | BDBM50005094 |
|---|
| Synonyms: | CHEMBL2424680 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H35N5O2 |
|---|
| Mol. Mass. | 485.6205 |
|---|
| SMILES | COc1ccc(CC(=O)N2CCC3(CN(C3)[C@H](C(C)C)c3ccc(cc3)-c3ncccn3)CC2)nc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
