Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM23928
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982298
IC50 14600±n/a nM
Citation St John SEJensen KCKang SChen YCalamini BMesecar ADLipton MA Design, synthesis, biological and structural evaluation of functionalized resveratrol analogues as inhibitors of quinone reductase 2. Bioorg Med Chem 21:6022-37 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23928
n/a
NameBDBM23928
Synonyms:1,3-dimethoxy-5-[(E)-2-(4-methoxyphenyl)ethenyl]benzene | CHEMBL296411 | trans-Stilbene Derivative, 4a
TypeSmall organic molecule
Emp. Form.C17H18O3
Mol. Mass.270.323
SMILESCOc1ccc(\C=C\c2cc(OC)cc(OC)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: