Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase B |
---|
Ligand | BDBM50440293 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_982569 (CHEMBL2428072) |
---|
Ki | 35±n/a nM |
---|
Citation | Malesevic, M; Gutknecht, D; Prell, E; Klein, C; Schumann, M; Nowak, RA; Simon, JC; Schiene-Fischer, C; Saalbach, A Anti-inflammatory effects of extracellular cyclosporins are exclusively mediated by CD147. J Med Chem56:7302-11 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase B |
---|
Name: | Peptidyl-prolyl cis-trans isomerase B |
Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
Type: | Protein |
Mol. Mass.: | 23751.82 |
Organism: | Homo sapiens (Human) |
Description: | P23284 |
Residue: | 216 |
Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
BDBM50440293 |
---|
n/a |
---|
Name | BDBM50440293 |
Synonyms: | CHEMBL2424822 |
Type | Small organic molecule |
Emp. Form. | C67H111N13O14 |
Mol. Mass. | 1322.6769 |
SMILES | CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)Cc2nc3ccc(cc3[nH]2)C(O)=O)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O)C(C)C |r| |
Structure |
|