| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM50440299 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_982571 (CHEMBL2428216) |
|---|
| Ki | 12±n/a nM |
|---|
| Citation |  Malesevic, M; Gutknecht, D; Prell, E; Klein, C; Schumann, M; Nowak, RA; Simon, JC; Schiene-Fischer, C; Saalbach, A Anti-inflammatory effects of extracellular cyclosporins are exclusively mediated by CD147. J Med Chem56:7302-11 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM50440299 |
|---|
| n/a |
|---|
| Name | BDBM50440299 |
|---|
| Synonyms: | CHEMBL2424823 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C67H113N13O12 |
|---|
| Mol. Mass. | 1292.694 |
|---|
| SMILES | CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)Cc2nc3ccc(C)cc3[nH]2)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O)C(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
