Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein delta homolog 1
LigandBDBM50441567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_988919
IC50 150±n/a nM
Citation Goodfellow VSLoweth CJRavula SBWiemann TNguyen TXu YTodd DESheppard DPollack SPolesskaya OMarker DFDewhurst SGelbard HA Discovery, synthesis, and characterization of an orally bioavailable, brain penetrant inhibitor of mixed lineage kinase 3. J Med Chem 56:8032-48 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein delta homolog 1
Name:Protein delta homolog 1
Synonyms:DLK-1 | FA1 | Fetal antigen 1 | pG2
Type:PROTEIN
Mol. Mass.:41294.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1444684
Residue:383
Sequence:
MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFT
GLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLA
VNIIFPEKIDMTTFSKEAGDEEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50441567
n/a
NameBDBM50441567
Synonyms:CHEMBL2436978
TypeSmall organic molecule
Emp. Form.C27H27N5
Mol. Mass.421.5368
SMILESCN1CCN(Cc2ccc(cc2)-c2cnc3[nH]cc(-c4ccc5[nH]ccc5c4)c3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: