| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neuropeptide Y receptor type 1 |
|---|
| Ligand | BDBM50015490 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_992054 (CHEMBL2447455) |
|---|
| Ki | 0.500000±n/a nM |
|---|
| Citation |  Berlicki, L; Kaske, M; Gutièrrez-Abad, R; Bernhardt, G; Illa, O; Ortuno, RM; Cabrele, C; Buschauer, A; Reiser, O Replacement of Thr32 and Gln34 in the C-terminal neuropeptide Y fragment 25-36 by cis-cyclobutane and cis-cyclopentane β-amino acids shifts selectivity toward the Y(4) receptor. J Med Chem56:8422-31 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neuropeptide Y receptor type 1 |
|---|
| Name: | Neuropeptide Y receptor type 1 |
|---|
| Synonyms: | NPY-Y1 | NPY1-R | NPY1R | NPY1R_HUMAN | NPYR | NPYY1 | neuropeptide Y receptor Y1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 44399.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | NPY-Y1 NPY1R HUMAN::P25929 |
|---|
| Residue: | 384 |
|---|
| Sequence: | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
|
|
|
|---|
| BDBM50015490 |
|---|
| n/a |
|---|
| Name | BDBM50015490 |
|---|
| Synonyms: | CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C189H285N55O57S |
|---|
| Mol. Mass. | 4271.685 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
