Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Meas. Tech.ChEMBL_992059
Ki 282±n/a nM
Citation Berlicki LKaske MGutièrrez-Abad RBernhardt GIlla OOrtuno RMCabrele CBuschauer AReiser O Replacement of Thr32 and Gln34 in the C-terminal neuropeptide Y fragment 25-36 by cis-cyclobutane and cis-cyclopentane β-amino acids shifts selectivity toward the Y(4) receptor. J Med Chem 56:8422-31 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
Name:Neuropeptide Y receptor type 4
Synonyms:NPY-Y4 | NPY4-R | Neuropeptide Y receptor type 4 | PP1 | Pancreatic polypeptide receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:42207.58
Organism:Homo sapiens (Human)
Description:NPY-Y4 PPYR1 HUMAN::P50391
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
Search PDB for entries with ligand similarity:Similarity to this molecule at least: