Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50442300 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_993380 (CHEMBL2444575) |
---|
Ki | 147±n/a nM |
---|
Citation | Sandham, DA; Arnold, N; Aschauer, H; Bala, K; Barker, L; Brown, L; Brown, Z; Budd, D; Cox, B; Docx, C; Dubois, G; Duggan, N; England, K; Everatt, B; Furegati, M; Hall, E; Kalthoff, F; King, A; Leblanc, CJ; Manini, J; Meingassner, J; Profit, R; Schmidt, A; Simmons, J; Sohal, B; Stringer, R; Thomas, M; Turner, KL; Walker, C; Watson, SJ; Westwick, J; Willis, J; Williams, G; Wilson, C Discovery and characterization of NVP-QAV680, a potent and selective CRTh2 receptor antagonist suitable for clinical testing in allergic diseases. Bioorg Med Chem21:6582-91 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50442300 |
---|
n/a |
---|
Name | BDBM50442300 |
Synonyms: | CHEMBL2442751 |
Type | Small organic molecule |
Emp. Form. | C17H15N3O4 |
Mol. Mass. | 325.3187 |
SMILES | Cc1c(CC(O)=O)c2cccnc2n1Cc1ccc(cc1)[N+]([O-])=O |
Structure |
|